PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29676.m001633
Common NameLOC8267241, RCOM_0602120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family LBD
Protein Properties Length: 310aa    MW: 34490.8 Da    PI: 6.8986
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29676.m001633genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.9e-4371061100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk++rrkC++dCv+apyfp +qp+kfan+hk+FGasnv kll++l++ +reda++sl+yeAear+rdPvyG+vg+i+ lq++l++l+++l  
  29676.m001633   7 PCAACKLQRRKCTQDCVFAPYFPPDQPQKFANLHKVFGASNVAKLLNELNTAQREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKELQSDLYN 102
                    7********************************************************************************************999 PP

         DUF260  97 lkee 100
                    +k+e
  29676.m001633 103 AKKE 106
                    8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6816107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSTPISPCAA CKLQRRKCTQ DCVFAPYFPP DQPQKFANLH KVFGASNVAK LLNELNTAQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HRLKELQSDL YNAKKELAQY IGPQAMLTTL  120
PAPTFMGQPH LGNPSSSLIQ HNALPIMGGI PAGTVHGHGG PLMIREPQQQ QQQHQIFEAQ  180
QLAAALAARE QQEMLRAYEQ QQQQQQEIVR FNRGYDVQDP VHNNTAGFNQ ITVAAMSPSL  240
ALGSFDTPYQ IQSQPLDHQQ QHQLQAQLFL QPTKVETPPQ QQHQFQQTQQ QQQQQQRSGS  300
DEGGSIGPSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576715.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ31e-78LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9S8K60.0B9S8K6_RICCO; Protein ASYMMETRIC LEAVES2, putative
STRINGVIT_07s0197g00030.t011e-100(Vitis vinifera)
STRINGPOPTR_0007s11460.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-70ASYMMETRIC LEAVES 2-like 1